PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID OGLUM05G17980.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; BOP clade; Oryzoideae; Oryzeae; Oryzinae; Oryza
Family NAC
Protein Properties Length: 320aa    MW: 34466.1 Da    PI: 9.0171
Description NAC family protein
Gene Model
Gene Model ID Type Source Coding Sequence
OGLUM05G17980.1genomeOGEView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1NAM164.24.7e-51171411128
              NAM   1 lppGfrFhPtdeelvveyLkkkvegkkleleevikevdiykvePwdLpkkvkaeekewyfFskrdkkyatgkrknratksgyWkatgkdkevls 94 
                      lppGfrFhPtdeelv++yL+++++g ++ +  +i+evd+yk++Pw+Lp+++  +ekewyfFs+rd+ky++g+r+nra+ sgyWkatg dk+v +
  OGLUM05G17980.1  17 LPPGFRFHPTDEELVMHYLCRRCAGLPIAV-PIIAEVDLYKFDPWHLPRMALYGEKEWYFFSPRDRKYPNGSRPNRAAGSGYWKATGADKPVGT 109
                      79**************************99.88***************7666789*************************************99 PP

              NAM  95 kkgelvglkktLvfykgrapkgektdWvmheyrl 128
                         + v +kk Lvfy g+apkg kt+W+mheyrl
  OGLUM05G17980.1 110 --PRPVAIKKALVFYAGKAPKGDKTNWIMHEYRL 141
                      ..779***************************98 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SuperFamilySSF1019417.85E-6212167IPR003441NAC domain
PROSITE profilePS5100559.40517167IPR003441NAC domain
PfamPF023653.6E-2618141IPR003441NAC domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0005634Cellular Componentnucleus
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 320 aa     Download sequence    Send to blast
MSGGEGAAAA ERQELQLPPG FRFHPTDEEL VMHYLCRRCA GLPIAVPIIA EVDLYKFDPW  60
HLPRMALYGE KEWYFFSPRD RKYPNGSRPN RAAGSGYWKA TGADKPVGTP RPVAIKKALV  120
FYAGKAPKGD KTNWIMHEYR LADVDRSARK KNTLRLDDWV LCRIYNKKGG VEKPSGGGGG  180
ERSNMMSHGK TASAGSPPEQ KPAVLPPPPP PYAAAAPFSE LAAFYDVRPS DSVPRAHGAD  240
SSCSEHVLTT SASSGGVVER PEVQSQPKIA EWERTFAGAA APAGAVSTAG PILGQLDPAA  300
VAGGGDPLLQ DILMYWGKPF
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
3ulx_A3e-791417312174Stress-induced transcription factor NAC1
Search in ModeBase
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankAK1077460.0AK107746.1 Oryza sativa Japonica Group cDNA clone:002-132-H04, full insert sequence.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_015637488.10.0PREDICTED: NAC domain-containing protein 48-like
SwissprotQ7F2L31e-155NAC48_ORYSJ; NAC domain-containing protein 48
TrEMBLA0A0D9ZZC40.0A0A0D9ZZC4_9ORYZ; Uncharacterized protein
STRINGLOC_Os05g34830.10.0(Oryza sativa Japonica Group)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MonocotsOGMP34173782
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT1G01720.11e-107NAC family protein